| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial |
|---|
| Ligand | BDBM50341708 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_743334 (CHEMBL1767581) |
|---|
| Ki | >100000±n/a nM |
|---|
| Citation |  Baragaña, B; McCarthy, O; Sánchez, P; Bosch-Navarrete, C; Kaiser, M; Brun, R; Whittingham, JL; Roberts, SM; Zhou, XX; Wilson, KS; Johansson, NG; González-Pacanowska, D; Gilbert, IH β-Branched acyclic nucleoside analogues as inhibitors of Plasmodium falciparum dUTPase. Bioorg Med Chem19:2378-91 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial |
|---|
| Name: | Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial |
|---|
| Synonyms: | DUT | DUT_HUMAN | Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) | Deoxyuridine triphosphatase (dUTPase) | dUTP pyrophosphatase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 26574.03 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P33316 |
|---|
| Residue: | 252 |
|---|
| Sequence: | MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSA
GRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLS
EHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKH
FIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTE
RGSGGFGSTGKN
|
|
|
|---|
| BDBM50341708 |
|---|
| n/a |
|---|
| Name | BDBM50341708 |
|---|
| Synonyms: | CHEMBL1766649 | rac-1-[2-(Diethylamido)-4-(tert-butyldiphenylsilyloxy)butyl]uracil |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H39N3O4Si |
|---|
| Mol. Mass. | 521.7232 |
|---|
| SMILES | CCN(CC)C(=O)C(CCO[Si](c1ccccc1)(c1ccccc1)C(C)(C)C)Cn1ccc(=O)[nH]c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
