| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Transcription factor Jun |
|---|
| Ligand | BDBM50342301 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_742816 (CHEMBL1769819) |
|---|
| IC50 | 7500±n/a nM |
|---|
| Citation |  De, SK; Barile, E; Chen, V; Stebbins, JL; Cellitti, JF; Machleidt, T; Carlson, CB; Yang, L; Dahl, R; Pellecchia, M Design, synthesis, and structure-activity relationship studies of thiophene-3-carboxamide derivatives as dual inhibitors of the c-Jun N-terminal kinase. Bioorg Med Chem19:2582-8 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Transcription factor Jun |
|---|
| Name: | Transcription factor Jun |
|---|
| Synonyms: | AP1 | Activator protein 1 | JUN | JUN_HUMAN | Proto-oncogene c-JUN | Transcription factor AP-1 | Transcription factor AP1 | V-jun avian sarcoma virus 17 oncogene homolog | p39 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 35683.24 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P05412 |
|---|
| Residue: | 331 |
|---|
| Sequence: | MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
|
|
|
|---|
| BDBM50342301 |
|---|
| n/a |
|---|
| Name | BDBM50342301 |
|---|
| Synonyms: | 2-(2-(benzo[b]thiophen-3-yl)acetamido)thiophene-3-carboxamide | CHEMBL1767254 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H12N2O2S2 |
|---|
| Mol. Mass. | 316.398 |
|---|
| SMILES | NC(=O)c1ccsc1NC(=O)Cc1csc2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
