| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HTH-type transcriptional regulator EthR |
|---|
| Ligand | BDBM50343350 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_745892 (CHEMBL1776262) |
|---|
| IC50 | 1600±n/a nM |
|---|
| Citation |  Flipo, M; Desroses, M; Lecat-Guillet, N; Dirié, B; Carette, X; Leroux, F; Piveteau, C; Demirkaya, F; Lens, Z; Rucktooa, P; Villeret, V; Christophe, T; Jeon, HK; Locht, C; Brodin, P; Déprez, B; Baulard, AR; Willand, N Ethionamide boosters: synthesis, biological activity, and structure-activity relationships of a series of 1,2,4-oxadiazole EthR inhibitors. J Med Chem54:2994-3010 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| HTH-type transcriptional regulator EthR |
|---|
| Name: | HTH-type transcriptional regulator EthR |
|---|
| Synonyms: | ETHR_MYCTU | HTH-type transcriptional regulator EthR | Transcriptional repressor EthR (EthR) | etaR | ethR |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 23751.94 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | P9WMC1 |
|---|
| Residue: | 216 |
|---|
| Sequence: | MTTSAASQASLPRGRRTARPSGDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPT
FYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPADTDRENMWRTGINVFFETFGSHKAV
TRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNE
RTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGENR
|
|
|
|---|
| BDBM50343350 |
|---|
| n/a |
|---|
| Name | BDBM50343350 |
|---|
| Synonyms: | 4,4,4-trifluoro-1-(4-(3-(thiophen-2-yl)-1,2,4-oxadiazol-5-yl)piperidin-1-yl)butan-1-one | CHEMBL1773966 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H16F3N3O2S |
|---|
| Mol. Mass. | 359.367 |
|---|
| SMILES | FC(F)(F)CCC(=O)N1CCC(CC1)c1nc(no1)-c1cccs1 |
|---|
| Structure | 
|
|---|
Search and Browse
