Reaction Details |
| Report a problem with these data |
Target | Uracil-DNA glycosylase |
---|
Ligand | BDBM50343404 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_747132 (CHEMBL1777498) |
---|
IC50 | 200000±n/a nM |
---|
Citation | Nuth, M; Huang, L; Saw, YL; Schormann, N; Chattopadhyay, D; Ricciardi, RP Identification of inhibitors that block vaccinia virus infection by targeting the DNA synthesis processivity factor D4. J Med Chem54:3260-7 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Uracil-DNA glycosylase |
---|
Name: | Uracil-DNA glycosylase |
Synonyms: | OPG116 | UDG | UNG | UNG_VACCW |
Type: | PROTEIN |
Mol. Mass.: | 25071.48 |
Organism: | Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strainWR)) |
Description: | ChEMBL_747132 |
Residue: | 218 |
Sequence: | MNSVTVSHAPYTITYHDDWEPVMSQLVEFYNEVASWLLRDETSPIPDKFFIQLKQPLRNK
RVCVCGIDPYPKDGTGVPFESPNFTKKSIKEIASSISRLTGVIDYKGYNLNIIDGVIPWN
YYLSCKLGETKSHAIYWDKISKLLLQHITKHVSVLYCLGKTDYSNIRAKLESPVTTIVGY
HPAARDRQFEKDRSFEIINVLLELDNKAPINWAQGFIY
|
|
|
BDBM50343404 |
---|
n/a |
---|
Name | BDBM50343404 |
Synonyms: | 4-bromo-2-(3-(3,4-dimethoxyphenylamino)imidazo[1,2-a]pyrimidin-2-yl)phenol | CHEMBL1574607 |
Type | Small organic molecule |
Emp. Form. | C20H17BrN4O3 |
Mol. Mass. | 441.278 |
SMILES | COc1ccc(Nc2c(nc3ncccn23)-c2cc(Br)ccc2O)cc1OC |
Structure |
|