Reaction Details |
| Report a problem with these data |
Target | B1 bradykinin receptor |
---|
Ligand | BDBM50344117 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_748609 (CHEMBL1780462) |
---|
IC50 | 0.6±n/a nM |
---|
Citation | Chen, JJ; Nguyen, T; D'Amico, DC; Qian, W; Human, J; Aya, T; Biswas, K; Fotsch, C; Han, N; Liu, Q; Nishimura, N; Peterkin, TA; Yang, K; Zhu, J; Riahi, BB; Hungate, RW; Andersen, NG; Colyer, JT; Faul, MM; Kamassah, A; Wang, J; Jona, J; Kumar, G; Johnson, E; Askew, BC 3-Oxo-2-piperazinyl acetamides as potent bradykinin B1 receptor antagonists for the treatment of pain and inflammation. Bioorg Med Chem Lett21:3384-9 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
B1 bradykinin receptor |
---|
Name: | B1 bradykinin receptor |
Synonyms: | B1 BRADYKININ | B1 bradykinin receptor | B1R | BDKRB1 | BK-1 receptor | BKRB1_HUMAN | BRADYB1 | Bradykinin B1 receptor |
Type: | Enzyme |
Mol. Mass.: | 40508.87 |
Organism: | Homo sapiens (Human) |
Description: | P46663 |
Residue: | 353 |
Sequence: | MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
|
|
|
BDBM50344117 |
---|
n/a |
---|
Name | BDBM50344117 |
Synonyms: | CHEMBL1777975 | N-((R)-6-((cyclopentylamino)methyl)-1,2,3,4-tetrahydronaphthalen-1-yl)-2-((R)-3-oxo-1-tosylpiperazin-2-yl)acetamide |
Type | Small organic molecule |
Emp. Form. | C29H38N4O4S |
Mol. Mass. | 538.701 |
SMILES | Cc1ccc(cc1)S(=O)(=O)N1CCNC(=O)[C@H]1CC(=O)N[C@@H]1CCCc2cc(CNC3CCCC3)ccc12 |r| |
Structure |
|