Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 2 |
---|
Ligand | BDBM50344803 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_749242 (CHEMBL1781185) |
---|
IC50 | 2400±n/a nM |
---|
Citation | Guerrero, M; Urbano, M; Velaparthi, S; Zhao, J; Schaeffer, MT; Brown, S; Rosen, H; Roberts, E Discovery, design and synthesis of the first reported potent and selective sphingosine-1-phosphate 4 (S1P4) receptor antagonists. Bioorg Med Chem Lett21:3632-6 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 2 |
---|
Name: | Sphingosine 1-phosphate receptor 2 |
Synonyms: | EDG5 | S1P2 | S1PR2 | S1PR2_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-5 | Sphingosine-1-phosphate receptor 2 | ndothelial differentiation G-protein coupled receptor 5 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 38883.16 |
Organism: | Homo sapiens (Human) |
Description: | Membranes isolated from S1P2-transfected CHO cells were used in ligand binding assay. |
Residue: | 353 |
Sequence: | MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
|
|
|
BDBM50344803 |
---|
n/a |
---|
Name | BDBM50344803 |
Synonyms: | 5-(2,5-dichlorophenyl)-N-(4-(2-hydroxyethoxy)-2,6-dimethylphenyl)furan-2-carboxamide | CHEMBL1779905 |
Type | Small organic molecule |
Emp. Form. | C21H19Cl2NO4 |
Mol. Mass. | 420.286 |
SMILES | Cc1cc(OCCO)cc(C)c1NC(=O)c1ccc(o1)-c1cc(Cl)ccc1Cl |
Structure |
|