| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E synthase |
|---|
| Ligand | BDBM50297878 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_748820 (CHEMBL1781668) |
|---|
| IC50 | 2900±n/a nM |
|---|
| Citation |  Greiner, C; Zettl, H; Koeberle, A; Pergola, C; Northoff, H; Schubert-Zsilavecz, M; Werz, O Identification of 2-mercaptohexanoic acids as dual inhibitors of 5-lipoxygenase and microsomal prostaglandin E2 synthase-1. Bioorg Med Chem19:3394-401 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E synthase |
|---|
| Name: | Prostaglandin E synthase |
|---|
| Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 17112.22 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 152 |
|---|
| Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
|---|
| BDBM50297878 |
|---|
| n/a |
|---|
| Name | BDBM50297878 |
|---|
| Synonyms: | 2-(4-(3-(2,3-dimethylphenoxy)propoxy)phenylthio)hexanoic acid | CHEMBL558141 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H30O4S |
|---|
| Mol. Mass. | 402.547 |
|---|
| SMILES | CCCCC(Sc1ccc(OCCCOc2cccc(C)c2C)cc1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
