Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlyceraldehyde-3-phosphate dehydrogenase, glycosomal
LigandBDBM50292429
Substrate/Competitorn/a
Meas. Tech.ChEMBL_749310
Ki 4000±n/a nM
Citation Pereira JMSeverino RPVieira PCFernandes JBda Silva MFZottis AAndricopulo ADOliva GCorrêa AG Anacardic acid derivatives as inhibitors of glyceraldehyde-3-phosphate dehydrogenase from Trypanosoma cruzi. Bioorg Med Chem 16:8889-95 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glyceraldehyde-3-phosphate dehydrogenase, glycosomal
Name:Glyceraldehyde-3-phosphate dehydrogenase, glycosomal
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:39070.68
Organism:Trypanosoma cruzi
Description:ChEMBL_973242
Residue:359
Sequence:
MPIKVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDMNTDAEYFAYQMRYDTVHGKFK
YEVTTTKSSPSVAKDDTLVVNGHRILCVKAQRNPADLPWGKLGVEYVIESTGLFTAKAAA
EGHLRGGARKVVISAPASGGAKTLVMGVNHHEYNPSEHHVVSNASCTTNCLAPIVHVLVK
EGFGVQTGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTQ
GKLTGMSFRVPTPDVSVVDLTFTAARDTSIQEIDAALKRASKTYMKGILGYTDEELVSAD
FINDNRSSIYDSKATLQNNLPKERRFFKIVSWYDNEWGYSHRVVDLVRHMASKDRSARL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50292429
n/a
NameBDBM50292429
Synonyms:2-Hydroxy-6-pentadecyl-benzoic acid | 2-Pentadecyl-6-hydroxybenzoic acid | 2-hydroxy-6-((8Z,11Z)-pentadeca-8,11,14-trienyl)benzoic acid | 2-hydroxy-6-pentadecylbenzoic acid | 6-[8(Z),11(Z),14-pentadecatrienyl]salicylic acid | 6-pentadecatrienylsalicylic acid | 6-pentadecylsalicylic acid | 6-{8(Z),11(Z),14-pentadecatrienyl}salicylic acid | 6[8'(Z ),11'(Z ),14'-pentadecatrienyl]salicylicacid | BPH-953 | CHEMBL455368 | anacardic acid
TypeSmall organic molecule
Emp. Form.C22H30O3
Mol. Mass.342.4718
SMILESOC(=O)c1c(O)cccc1CCCCCCC\C=C/C\C=C/CC=C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: