| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bis(5'-adenosyl)-triphosphatase |
|---|
| Ligand | BDBM50350515 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_762663 (CHEMBL1817387) |
|---|
| Ki | 35±n/a nM |
|---|
| Citation |  Krakowiak, A; Pecherzewska, R; Kaczmarek, R; Tomaszewska, A; Nawrot, B; Stec, WJ Evaluation of influence of Ap4A analogues on Fhit-positive HEK293T cells; cytotoxicity and ability to induce apoptosis. Bioorg Med Chem19:5053-60 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bis(5'-adenosyl)-triphosphatase |
|---|
| Name: | Bis(5'-adenosyl)-triphosphatase |
|---|
| Synonyms: | AP3A hydrolase | AP3Aase | Bis(5'adenosyl)-triphosphatase | Dinucleosidetriphosphatase | FHIT | FHIT_HUMAN | Fragile histidine triad protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 16861.00 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P49789 |
|---|
| Residue: | 147 |
|---|
| Sequence: | MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ
TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH
DKEDFPASWRSEEEMAAEAAALRVYFQ
|
|
|
|---|
| BDBM50350515 |
|---|
| n/a |
|---|
| Name | BDBM50350515 |
|---|
| Synonyms: | CHEMBL1812067 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C35H49N15O21P4S4 |
|---|
| Mol. Mass. | 1268.007 |
|---|
| SMILES | Nc1ncnc2n(cnc12)[C@@H]1O[C@H](COP(S)(=O)OCC(COP(O)(S)=O)(COP(S)(=O)OC[C@H]2O[C@H]([C@H](O)[C@@H]2O)n2cnc3c(N)ncnc23)COP(S)(=O)OC[C@H]2O[C@H]([C@H](O)[C@@H]2O)n2cnc3c(N)ncnc23)[C@@H](O)[C@H]1O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
