Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoglyceride Lipase (MGL)
LigandBDBM50350559
Substrate/Competitorn/a
Meas. Tech.ChEMBL_762787
IC50 19±n/a nM
Citation Otrubova KEzzili CBoger DL The discovery and development of inhibitors of fatty acid amide hydrolase (FAAH). Bioorg Med Chem Lett 21:4674-85 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoglyceride Lipase (MGL)
Name:Monoglyceride Lipase (MGL)
Synonyms:MAG lipase | Monoacylglycerol lipase
Type:Hydrolase
Mol. Mass.:33391.67
Organism:Mus musculus (mouse)
Description:Assays were using membranes of recombinant MAG Lipase transiently transfected in COS-7 cells.
Residue:303
Sequence:
MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDE
LAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLG
HSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRID
SSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADR
LCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAG
CPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50350559
n/a
NameBDBM50350559
Synonyms:CHEMBL1812718
TypeSmall organic molecule
Emp. Form.C25H24N2O5
Mol. Mass.432.4685
SMILES[O-][N+](=O)c1ccc(OC(=O)N2CCC(Cc3cccc(Oc4ccccc4)c3)CC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: