Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M3
LigandBDBM50355631
Substrate/Competitorn/a
Meas. Tech.ChEMBL_776531
IC50 3.48±n/a nM
Citation Glossop PAWatson CAPrice DABunnage MEMiddleton DSWood AJames KRoberts DStrang RSYeadon MPerros-Huguet CClarke NPTrevethick MAMachin IStuart EFEvans SMHarrison ACFairman DAAgoram BBurrows JLFeeder NFulton CKDillon BREntwistle DASpence FJ Inhalation by design: novel tertiary amine muscarinic M3 receptor antagonists with slow off-rate binding kinetics for inhaled once-daily treatment of chronic obstructive pulmonary disease. J Med Chem 54:6888-904 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M3
Name:Muscarinic acetylcholine receptor M3
Synonyms:GPM3 | Muscarinic acetylcholine receptor
Type:n/a
Mol. Mass.:66272.13
Organism:Cavia porcellus
Description:n/a
Residue:587
Sequence:
MTLHSNSTTLPLFPNISTSWIHSPSEAGLPPGTVTHFGSYNISQAAGNFSSLNGTTSDPL
GGHTIWQVVFIAFLTGFLALVTIIGNILVIVSFKVNKQLKHVNNYFLLSLADLIIGVISM
NLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTT
KRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYM
PVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSLKH
SSRRKYSRCHFWFATKSWKPNAGQMDQDHSSSDSWNNYDAAASLENSASDEEDIGSETRA
IYSIVLKLPGHSTILNSTKLPSSDNLQVPEEDLEPMDMERNASKPQTQKSMDDGGSFQKS
FSNLPIQLESTMDTAKTSDANSSVSKTMATLPLSFKEATLAKRFALRTRSQITKRKRMSL
IKEKRAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVC
YALCNKTFRNTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50355631
n/a
NameBDBM50355631
Synonyms:CHEMBL1910865
TypeSmall organic molecule
Emp. Form.C28H31FN2O3
Mol. Mass.462.5557
SMILESCC(C)(CCC(C(N)=O)(c1ccccc1)c1ccccc1)N1CC(C1)Oc1cccc(O)c1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: