| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor EP2 subtype |
|---|
| Ligand | BDBM50355879 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_775625 (CHEMBL1913309) |
|---|
| IC50 | >1000±n/a nM |
|---|
| Citation |  Stasi, LP; Bhimani, K; Borriello, M; Canciani, L; Caselli, G; Colace, F; Ferioli, C; Kaswala, M; Mennuni, L; Piepoli, T; Pucci, S; Salvi, M; Shirsath, V; Zanelli, T; Zerbi, S Synthesis, pharmacophore modeling and in vitro activity of 10,11-dihydrodibenzo[b,f]oxepine-4-carboxamide derivatives as novel and potent antagonists of the prostaglandin EP4 receptor. Bioorg Med Chem Lett21:6336-40 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E2 receptor EP2 subtype |
|---|
| Name: | Prostaglandin E2 receptor EP2 subtype |
|---|
| Synonyms: | PE2R2_HUMAN | PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP4 subtype | Prostanoid EP2 Receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39775.71 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P43116 |
|---|
| Residue: | 358 |
|---|
| Sequence: | MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
|
|
|
|---|
| BDBM50355879 |
|---|
| n/a |
|---|
| Name | BDBM50355879 |
|---|
| Synonyms: | CHEMBL1910023 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H20F3NO4 |
|---|
| Mol. Mass. | 467.4365 |
|---|
| SMILES | OC(=O)c1ccc(cc1)C1(CC1)NC(=O)c1cccc2CCc3ccc(cc3Oc12)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
