Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetabotropic glutamate receptor 4 (mGlu4)
LigandBDBM55095
Substrate/Competitorn/a
Meas. Tech.ChEMBL_788858
EC50 536±n/a nM
Citation Jones CKEngers DWThompson ADField JRBlobaum ALLindsley SRZhou YGogliotti RDJadhav SZamorano RBogenpohl JSmith YMorrison RDaniels JSWeaver CDConn PJLindsley CWNiswender CMHopkins CR Discovery, synthesis, and structure-activity relationship development of a series of N-4-(2,5-dioxopyrrolidin-1-yl)phenylpicolinamides (VU0400195, ML182): characterization of a novel positive allosteric modulator of the metabotropic glutamate receptor 4 (mGlu(4)) with oral efficacy in an antiparkin J Med Chem 54:7639-47 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Metabotropic glutamate receptor 4 (mGlu4)
Name:Metabotropic glutamate receptor
Synonyms:GRM4 | Metabotropic glutamate receptor | mGlu4 | metabotropic glutamate 4 | metabotropic glutamate 4a
Type:Enzyme
Mol. Mass.:101849.79
Organism:Rattus norvegicus (Rat)
Description:P31423
Residue:912
Sequence:
MSGKGGWAWWWARLPLCLLLSLYAPWVPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGR
GSEGKACGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSL
TFVQALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYA
STAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTLASEGSYGESGVEAFIQ
KSRENGGVCIAQSVKIPREPKTGEFDKIIKRLLETSNARGIIIFANEDDIRRVLEAARRA
NQTGHFFWMGSDSWGSKSAPVLRLEEVAEGAVTILPKRMSVRGFDRYFSSRTLDNNRRNI
WFAEFWEDNFHCKLSRHALKKGSHIKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQY
QLRNGSAEYKVIGSWTDHLHLRIERMQWPGSGQQLPRSICSLPCQPGERKKTVKGMACCW
HCEPCTGYQYQVDRYTCKTCPYDMRPTENRTSCQPIPIVKLEWDSPWAVLPLFLAVVGIA
ATLFVVVTFVRYNDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLGTCSLRRIFLG
LGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFILISLQLLGICVWFVV
DPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVYAIKTRGVPET
FNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMP
KVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLETPALAT
KQTYVTYTNHAI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM55095
n/a
NameBDBM55095
Synonyms:N-[3-chloranyl-4-[3-methyl-2,5-bis(oxidanylidene)-3-phenyl-pyrrolidin-1-yl]phenyl]pyridine-2-carboxamide | N-[3-chloro-4-(2,5-diketo-3-methyl-3-phenyl-pyrrolidino)phenyl]picolinamide | N-[3-chloro-4-(3-methyl-2,5-dioxo-3-phenyl-1-pyrrolidinyl)phenyl]-2-pyridinecarboxamide | N-[3-chloro-4-(3-methyl-2,5-dioxo-3-phenylpyrrolidin-1-yl)phenyl]pyridine-2-carboxamide | VU0404997-2 | cid_46869952
TypeSmall organic molecule
Emp. Form.C23H18ClN3O3
Mol. Mass.419.86
SMILESCC1(CC(=O)N(C1=O)c1ccc(NC(=O)c2ccccn2)cc1Cl)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: