Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHemagglutinin
LigandBDBM50360450
Substrate/Competitorn/a
Meas. Tech.ChEMBL_795514
IC50 7810±n/a nM
Citation Suzuki KKoyama TYingsakmongkon SSuzuki YHatano KMatsuoka K Synthesis and biological evaluation of sialic acid derivatives containing a long hydrophobic chain at the anomeric position and their C-5 linked polymers as potent influenza virus inhibitors. Bioorg Med Chem 20:446-54 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Hemagglutinin
Name:Hemagglutinin
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:63355.67
Organism:Influenza A virus (strain A/Puerto Rico/8/1934 H1N1)
Description:ChEMBL_795514
Residue:565
Sequence:
MKANLLVLLCALAAADADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCR
LKGIAPLQLGKCNIAGWLLGNPECDPLLPVRSWSYIVETPNSENGICYPGDFIDYEELRE
QLSSVSSFERFEIFPKESSWPNHNTNGVTAACSHEGKSSFYRNLLWLTEKEGSYPKLKNS
YVNKKGKEVLVLWGIHHPPNSKEQQNLYQNENAYVSVVTSNYNRRFTPEIAERPKVRDQA
GRMNYYWTLLKPGDTIIFEANGNLIAPMYAFALSRGFGSGIITSNASMHECNTKCQTPLG
AINSSLPYQNIHPVTIGECPKYVRSAKLRMVTGLRNIPSIQSRGLFGAIAGFIEGGWTGM
IDGWYGYHHQNEQGSGYAADQKSTQNAINGITNKVNTVIEKMNIQFTAVGKEFNKLEKRM
ENLNKKVDDGFLDIWTYNAELLVLLENERTLDFHDSNVKNLYEKVKSQLKNNAKEIGNGC
FEFYHKCDNECMESVRNGTYDYPKYSEESKLNREKVDGVKLESMGIYQILAIYSTVASSL
VLLVSLGAISFWMCSNGSLQCRICI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50360450
n/a
NameBDBM50360450
Synonyms:CHEMBL1934618
TypeSmall organic molecule
Emp. Form.C24H43NO8S
Mol. Mass.505.665
SMILESCCCCCCCCCCCCS[C@@]1(C[C@H](O)[C@@H](NC(=O)C=C)[C@@H](O1)[C@H](O)[C@H](O)CO)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: