| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 4 |
|---|
| Ligand | BDBM75601 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_795350 (CHEMBL1937206) |
|---|
| EC50 | 570±n/a nM |
|---|
| Citation |  Guerrero, M; Urbano, M; Zhao, J; Crisp, M; Chase, P; Hodder, P; Schaeffer, MT; Brown, S; Rosen, H; Roberts, E Discovery, design and synthesis of novel potent and selective sphingosine-1-phosphate 4 receptor (S1P4-R) agonists. Bioorg Med Chem Lett22:537-42 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 4 |
|---|
| Name: | Sphingosine 1-phosphate receptor 4 |
|---|
| Synonyms: | EDG6 | Endothelial differentiation G-protein coupled receptor 6 | S1P receptor 4 | S1P receptor Edg-6 | S1P4 | S1PR4 | S1PR4_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-6 | Sphingosine-1-phosphate receptor 4 | sphingosine-1-phosphate 4 S1P4 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 41647.39 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 384 |
|---|
| Sequence: | MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV
VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL
REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP
LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP
AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS
AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS
FRGSRSLSFRMREPLSSISSVRSI
|
|
|
|---|
| BDBM75601 |
|---|
| n/a |
|---|
| Name | BDBM75601 |
|---|
| Synonyms: | 6-methyl-2-nitro-3-[2-(2,4,6-trichlorophenoxy)ethoxy]pyridine | 6-methyl-2-nitro-3-[2-[2,4,6-tris(chloranyl)phenoxy]ethoxy]pyridine | CYM50174 | SR-02000000303 | SR-02000000303-1 | cid_44620882 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H11Cl3N2O4 |
|---|
| Mol. Mass. | 377.607 |
|---|
| SMILES | Cc1ccc(OCCOc2c(Cl)cc(Cl)cc2Cl)c(n1)[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
