Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine receptor (H3)
LigandBDBM50360899
Substrate/Competitorn/a
Meas. Tech.ChEMBL_795468
Ki 1.9±n/a nM
Citation Hudkins RLAimone LDDandu RRDunn DGruner JAHuang ZJosef KALyons JAMathiasen JRTao MZulli ALRaddatz R 4,5-dihydropyridazin-3-one derivatives as histamine H3 receptor inverse agonists. Bioorg Med Chem Lett 22:194-8 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine receptor (H3)
Name:Histamine receptor (H3 and H4)
Synonyms:G-protein coupled receptor 97 | HH3R | HISTAMINE H3 | HRH3 | Histamine H3 Receptor | Histamine H3 receptor (H3) | Histamine H3L | Histamine receptor (H3 and H4)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:48691.47
Organism:Homo sapiens (Human)
Description:Binding assays were using CHO cells stably expressing hH3R receptors.
Residue:445
Sequence:
MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS
SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA
GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL
AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR
RAFTKLLCPQKLKIQPHSSLEHCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50360899
n/a
NameBDBM50360899
Synonyms:CHEMBL1935110
TypeSmall organic molecule
Emp. Form.C19H27N3O2
Mol. Mass.329.4366
SMILESC[C@@H]1CCCN1CCCOc1ccc(cc1)C1=NNC(=O)C(C)C1 |r,t:18|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: