| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitogen-activated protein kinase 14 |
|---|
| Ligand | BDBM50361467 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_797142 (CHEMBL1942369) |
|---|
| Kd | 0.001000±n/a nM |
|---|
| Citation |  Millan, DS; Bunnage, ME; Burrows, JL; Butcher, KJ; Dodd, PG; Evans, TJ; Fairman, DA; Hughes, SJ; Kilty, IC; Lemaitre, A; Lewthwaite, RA; Mahnke, A; Mathias, JP; Philip, J; Smith, RT; Stefaniak, MH; Yeadon, M; Phillips, C Design and synthesis of inhaled p38 inhibitors for the treatment of chronic obstructive pulmonary disease. J Med Chem54:7797-814 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mitogen-activated protein kinase 14 |
|---|
| Name: | Mitogen-activated protein kinase 14 |
|---|
| Synonyms: | CSAID-binding protein | CSBP | CSBP1 | CSBP2 | CSPB1 | Cytokine suppressive anti-inflammatory drug-binding protein | MAP kinase 14 | MAP kinase MXI2 | MAP kinase p38 alpha | MAPK 14 | MAPK14 | MAX-interacting protein 2 | MK14_HUMAN | MXI2 | Mitogen-activated protein kinase p38 alpha | SAPK2A | Stress-activated protein kinase 2a | p38 MAP kinase alpha/beta |
|---|
| Type: | Serine/threonine-protein kinase |
|---|
| Mol. Mass.: | 41286.76 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q16539 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
|
|
|
|---|
| BDBM50361467 |
|---|
| n/a |
|---|
| Name | BDBM50361467 |
|---|
| Synonyms: | CHEMBL1938400 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C35H34ClN7O3S2 |
|---|
| Mol. Mass. | 700.273 |
|---|
| SMILES | CC(C)(C)c1cc(NC(=O)NCc2ccccc2Sc2ccc3nnc(-c4ccccc4SCCO)n3c2)n(n1)-c1ccc(O)c(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
