| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HTH-type transcriptional regulator EthR |
|---|
| Ligand | BDBM50363019 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_800731 (CHEMBL1947974) |
|---|
| EC50 | 20000±n/a nM |
|---|
| Citation |  Flipo, M; Desroses, M; Lecat-Guillet, N; Villemagne, B; Blondiaux, N; Leroux, F; Piveteau, C; Mathys, V; Flament, MP; Siepmann, J; Villeret, V; Wohlkönig, A; Wintjens, R; Soror, SH; Christophe, T; Jeon, HK; Locht, C; Brodin, P; Déprez, B; Baulard, AR; Willand, N Ethionamide boosters. 2. Combining bioisosteric replacement and structure-based drug design to solve pharmacokinetic issues in a series of potent 1,2,4-oxadiazole EthR inhibitors. J Med Chem55:68-83 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| HTH-type transcriptional regulator EthR |
|---|
| Name: | HTH-type transcriptional regulator EthR |
|---|
| Synonyms: | ETHR_MYCTU | HTH-type transcriptional regulator EthR | Transcriptional repressor EthR (EthR) | etaR | ethR |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 23751.94 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | P9WMC1 |
|---|
| Residue: | 216 |
|---|
| Sequence: | MTTSAASQASLPRGRRTARPSGDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPT
FYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPADTDRENMWRTGINVFFETFGSHKAV
TRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNE
RTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGENR
|
|
|
|---|
| BDBM50363019 |
|---|
| n/a |
|---|
| Name | BDBM50363019 |
|---|
| Synonyms: | CHEMBL1945814 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H16F3N5O2 |
|---|
| Mol. Mass. | 355.315 |
|---|
| SMILES | FC(F)(F)CCC(=O)N1CCC(CC1)c1nc(no1)-c1cnccn1 |
|---|
| Structure | 
|
|---|
Search and Browse
