Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLipoprotein lipase
LigandBDBM50364293
Substrate/Competitorn/a
Meas. Tech.ChEMBL_804416
IC50>50000±n/a nM
Citation O'Connell DPLeBlanc DFCromley DBillheimer JRader DJBachovchin WW Design and synthesis of boronic acid inhibitors of endothelial lipase. Bioorg Med Chem Lett 22:1397-401 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lipoprotein lipase
Name:Lipoprotein lipase
Synonyms:LPL
Type:PROTEIN
Mol. Mass.:53173.96
Organism:Homo sapiens (Human)
Description:ChEMBL_1280894
Residue:475
Sequence:
MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGV
AESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEH
YPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRIT
GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
PGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKG
LCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQ
AFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDW
WSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50364293
n/a
NameBDBM50364293
Synonyms:CHEMBL1952305
TypeSmall organic molecule
Emp. Form.C23H39BO2
Mol. Mass.358.366
SMILESCCCCCCCCCCCc1ccc(cc1)B1OC(C)(C)C(C)(C)O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: