Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG protein-coupled receptor 44
LigandBDBM50364534
Substrate/Competitorn/a
Meas. Tech.ChEMBL_802808
IC50 4±n/a nM
Citation Liu JJWang YJohnson MGLi ARShen WWang XSu YBrown MVan Lengerich BRickel EMartin TBudelsky ASeitz LDanao JTang HLCollins TMedina JC Optimization of phenylacetic acid derivatives for balanced CRTH2 and DP dual antagonists. Bioorg Med Chem Lett 22:1686-9 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
G protein-coupled receptor 44
Name:G protein-coupled receptor 44
Synonyms:CD_antigen=CD294 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | G-protein coupled receptor 44 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2)
Type:Enzyme
Mol. Mass.:43295.45
Organism:Homo sapiens (Human)
Description:Q9Y5Y4
Residue:395
Sequence:
MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50364534
n/a
NameBDBM50364534
Synonyms:CHEMBL1950877
TypeSmall organic molecule
Emp. Form.C26H24Cl2N4O6S
Mol. Mass.591.463
SMILESCCCc1nnc([nH]1)-c1ccc(Oc2ccc(CC(O)=O)cc2OC)c(NS(=O)(=O)c2ccc(Cl)cc2Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: