| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin D2 receptor |
|---|
| Ligand | BDBM50364532 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_802809 (CHEMBL1953543) |
|---|
| IC50 | 15±n/a nM |
|---|
| Citation |  Liu, JJ; Wang, Y; Johnson, MG; Li, AR; Shen, W; Wang, X; Su, Y; Brown, M; Van Lengerich, B; Rickel, E; Martin, T; Budelsky, A; Seitz, L; Danao, J; Tang, HL; Collins, T; Medina, JC Optimization of phenylacetic acid derivatives for balanced CRTH2 and DP dual antagonists. Bioorg Med Chem Lett22:1686-9 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin D2 receptor |
|---|
| Name: | Prostaglandin D2 receptor |
|---|
| Synonyms: | PD2R_HUMAN | PTGDR | Prostaglandin D2 | Prostaglandin D2 receptor | Prostanoid DP receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40288.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q13258 |
|---|
| Residue: | 359 |
|---|
| Sequence: | MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
|
|
|
|---|
| BDBM50364532 |
|---|
| n/a |
|---|
| Name | BDBM50364532 |
|---|
| Synonyms: | CHEMBL1950875 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H22Cl2N4O6S |
|---|
| Mol. Mass. | 577.436 |
|---|
| SMILES | CCc1nnc([nH]1)-c1ccc(Oc2ccc(CC(O)=O)cc2OC)c(NS(=O)(=O)c2ccc(Cl)cc2Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
