new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeutral Endopeptidase (NEP)
LigandBDBM50283607
Substrate/Competitorn/a
Meas. Tech.ChEMBL_144624
Ki 26±n/a nM
Citation Bhagwat SSFink CAGude CChan KQiao YSakane YBerry CGhai RD 4-Substituted proline derivatives that inhibit angiotensin converting enzyme and neutral endopeptidase 24.11. Bioorg Med Chem Lett 4:2673-2676 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Neutral Endopeptidase (NEP)
Name:Neprilysin
Synonyms:Neutral endopeptidase 24.11
Type:Protein
Mol. Mass.:85789.59
Organism:Rattus norvegicus (Rat)
Description:P07861
Residue:750
Sequence:
MGRSESQMDITDINAPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDASAEPCTDFFKYACGGWLKRNVIPETSSRYSNFDILRDELEVILKD
VLQEPKTEDIVAVQKAKTLYRSCINESAIDSRGGQPLLTLLPDIYGWPVASQNWEQTYGT
SWTAEKSIAQLNSKYGKKVLINFFVGTDDKNSTQHIIHFDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMISVARLIRQEQRLPIDENQLSLEMNKVMELEKEIANATTKPEDRNDPMLLY
NKMTLAKLQNNFSLEINGKPFSWSNFTNEIMSTVNINIQNEEEVVVYAPEYLTKLKPILT
KYSPRDLQNLMSWRFIMDLVSSLSRNYKESRNAFRKALYGTTSETATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKKAEEKALAIKERI
GYPDDIISNENKLNNEYLELNYKEEEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAA
VVNAFYSSGRNQIVFPAGILQPPFFSARQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSANNFKDQSQCMVYQYGNFTWDLAGGQHLNGINTLGENIADNGGIGQAYR
AYQNYVKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GTLQNSAEFADAFHCRKNSYMNPERKCRVW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50283607
n/a
NameBDBM50283607
Synonyms:7-(2-Mercaptomethyl-3-phenyl-propionylamino)-heptanoic acid | CHEMBL328519
TypeSmall organic molecule
Emp. Form.C17H25NO3S
Mol. Mass.323.45
SMILESOC(=O)CCCCCCNC(=O)C(CS)Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: