BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalpain-2 (m-Calpain)
LigandBDBM50284780
Substrate/Competitorn/a
Meas. Tech.ChEMBL_43856
IC50 104±n/a nM
Citation Woo JSigeizumi SYamaguchi KSugimoto KKobori TTsuji TKondo K Peptidyl aldehyde derivatives as potent and selective inhibitors of cathepsin L Bioorg Med Chem Lett 5:1501-1504 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Calpain-2 (m-Calpain)
Name:Calpain1/2
Synonyms:CANP 2 | Calcium-activated neutral proteinase 2 | Calpain 2 | Calpain M-type | Calpain large polypeptide L2 | Calpain-2 catalytic subunit | Calpain-2 large subunit | Calpain1/2 | M-calpain | Millimolar-calpain | calpain
Type:Protein
Mol. Mass.:79965.18
Organism:Homo sapiens (Human)
Description:n/a
Residue:700
Sequence:
MAGIAAKLAKDREAAEGLGSHDRAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGF
KELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEI
LARVVPLNQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSAL
LEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGC
SIDITSAADSEAITFQKLVKGHAYSVTGAEEVESNGSLQKLIRIRNPWGEVEWTGRWNDN
CPSWNTIDPEERERLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTK
MDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEEDGESGCTFLVGLIQKHRRRQR
KMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLTNRARERSDTFINLREVLNRFKLPPG
EYILVPSTFEPNKDGDFCIRVFSEKKADYQAVDDEIEANLEEFDISEDDIDDGFRRLFAQ
LAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYIL
WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQLIIDFD
NFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50284780
n/a
NameBDBM50284780
Synonyms:CHEMBL36801 | Z-Phe-Phe-H
TypeSmall organic molecule
Emp. Form.C26H26N2O5
Mol. Mass.446.495
SMILESOC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)OCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: