| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50031299 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_149641 |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  Pevarello, P; Bonsignori, A; Caccia, C; Amici, R; McArthur, RA; Fariello, RG; Salvati, P; Varasi, M Sodium channel activity and sigma binding of 2-aminopropanamide anticonvulsants. Bioorg Med Chem Lett9:2521-4 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50031299 |
|---|
| n/a |
|---|
| Name | BDBM50031299 |
|---|
| Synonyms: | 6-(2,3-Dichloro-phenyl)-[1,2,4]triazine-3,5-diamine | 6-(2,3-Dichloro-phenyl)-[1,2,4]triazine-3,5-diamine(lamotrigine) | 6-(2,3-dichlorophenyl)-1,2,4-triazine-3,5-diamine | BW-430C | CHEMBL741 | LAMOTRIGINE | Lamictal | Lamictal cd |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H7Cl2N5 |
|---|
| Mol. Mass. | 256.091 |
|---|
| SMILES | Nc1nnc(c(N)n1)-c1cccc(Cl)c1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
