Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50031299 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_149641 |
---|
IC50 | >10000±n/a nM |
---|
Citation | Pevarello, P; Bonsignori, A; Caccia, C; Amici, R; McArthur, RA; Fariello, RG; Salvati, P; Varasi, M Sodium channel activity and sigma binding of 2-aminopropanamide anticonvulsants. Bioorg Med Chem Lett9:2521-4 (1999) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50031299 |
---|
n/a |
---|
Name | BDBM50031299 |
Synonyms: | 6-(2,3-Dichloro-phenyl)-[1,2,4]triazine-3,5-diamine | 6-(2,3-Dichloro-phenyl)-[1,2,4]triazine-3,5-diamine(lamotrigine) | 6-(2,3-dichlorophenyl)-1,2,4-triazine-3,5-diamine | BW-430C | CHEMBL741 | LAMOTRIGINE | Lamictal | Lamictal cd |
Type | Small organic molecule |
Emp. Form. | C9H7Cl2N5 |
Mol. Mass. | 256.091 |
SMILES | Nc1nnc(c(N)n1)-c1cccc(Cl)c1Cl |
Structure |
|