Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNociceptin/mu opioid receptor
LigandBDBM21015
Substrate/Competitorn/a
Meas. Tech.ChEMBL_149004
Ki 0.530000±n/a nM
Citation Longobardo LMelck DSiciliano RSantini ADi Marzo VCammarota G Beta-casomorphins: substitution of phenylalanine with beta-homo phenylalanine increases the mu-type opioid receptor affinity. Bioorg Med Chem Lett 10:1185-8 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Nociceptin/mu opioid receptor
Name:Nociceptin/mu opioid receptor
Synonyms:MOR-1 | MUOR1 | Mu-type opioid receptor | Mu-type opioid receptor (MOR) | OPIATE Mu | Opiate non-selective | Opioid receptor B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44503.11
Organism:Rattus norvegicus (rat)
Description:Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor.
Residue:398
Sequence:
MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21015
n/a
NameBDBM21015
Synonyms:(2S)-2-{2-[(2R)-2-[(2S)-2-amino-3-(4-hydroxyphenyl)propanamido]propanamido]-N-methylacetamido}-N-(2-hydroxyethyl)-3-phenylpropanamide | 2-Ala-4-MePhe-5-Gly-Enkephalin | CHEMBL38874 | D-Ala2-MePhe4-Met(0)5-enkephalin-ol | DAMGO | RX 783006 | [3H]DAMGO | [tyrosyl-3,5-3H(N)]-D-Ala2-Mephe4-glyol5-enkephalin
TypeAnalgesics
Emp. Form.C26H35N5O6
Mol. Mass.513.586
SMILESC[C@@H](NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)NCC(=O)N(C)[C@@H](Cc1ccccc1)C(=O)NCCO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: