Reaction Details |
| Report a problem with these data |
Target | Dual specificity protein phosphatase 3 |
---|
Ligand | BDBM50086648 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_214525 |
---|
Ki | 26000000±n/a nM |
---|
Citation | Ibrahimi, OA; Wu, L; Zhao, K; Zhang, ZY Synthesis and characterization of a novel class of protein tyrosine phosphatase inhibitors. Bioorg Med Chem Lett10:457-60 (2000) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dual specificity protein phosphatase 3 |
---|
Name: | Dual specificity protein phosphatase 3 |
Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
Type: | Hydrolase |
Mol. Mass.: | 20480.58 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 185 |
Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
BDBM50086648 |
---|
n/a |
---|
Name | BDBM50086648 |
Synonyms: | phenoxymethylphosphonate |
Type | Small organic molecule |
Emp. Form. | C7H7O4P |
Mol. Mass. | 186.1029 |
SMILES | [O-]P([O-])(=O)COc1ccccc1 |
Structure |
|