| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50105592 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_80617 |
|---|
| IC50 | 6330±n/a nM |
|---|
| Citation |  Tillekeratne, LM; Sherette, A; Grossman, P; Hupe, L; Hupe, D; Hudson, RA Simplified catechin-gallate inhibitors of HIV-1 reverse transcriptase. Bioorg Med Chem Lett11:2763-7 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50105592 |
|---|
| n/a |
|---|
| Name | BDBM50105592 |
|---|
| Synonyms: | 2,3,4-Trihydroxy-benzoic acid 2-(6,7-dihydroxy-chroman-3-yl)-ethyl ester | CHEMBL92138 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H18O8 |
|---|
| Mol. Mass. | 362.3307 |
|---|
| SMILES | Oc1ccc(C(=O)OCCC2COc3cc(O)c(O)cc3C2)c(O)c1O |
|---|
| Structure | 
|
|---|
Search and Browse
