Reaction Details |
| Report a problem with these data |
Target | Carbonic anhydrase 4 |
---|
Ligand | BDBM50097287 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_219473 |
---|
Ki | 7±n/a nM |
---|
Citation | Scozzafava, A; Menabuoni, L; Mincione, F; Mincione, G; Supuran, CT Carbonic anhydrase inhibitors: synthesis of sulfonamides incorporating dtpa tails and of their zinc complexes with powerful topical antiglaucoma properties. Bioorg Med Chem Lett11:575-82 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Carbonic anhydrase 4 |
---|
Name: | Carbonic anhydrase 4 |
Synonyms: | CA-IV | CA4 | CAH4_HUMAN | Carbonate dehydratase IV | Carbonic anhydrase | Carbonic anhydrase 4 (CA IV) | Carbonic anhydrase IV (CA IV) |
Type: | Enzyme |
Mol. Mass.: | 35037.98 |
Organism: | Homo sapiens (Human) |
Description: | P22748 |
Residue: | 312 |
Sequence: | MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTK
AKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSD
LPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF
QPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFRE
PIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
PMLACLLAGFLR
|
|
|
BDBM50097287 |
---|
n/a |
---|
Name | BDBM50097287 |
Synonyms: | CHEMBL432083 | Zinc{{2-[Carboxymethyl-(2-{carboxymethyl-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-ethyl)-amino]-ethyl}-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-acetic acid | {{2-[Carboxymethyl-(2-{carboxymethyl-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-ethyl)-amino]-ethyl}-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-acetic acid | {{2-[Carboxymethyl-(2-{carboxymethyl-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-ethyl)-amino]-ethyl}-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-acetic acid; compound with Cu complex | {{2-[Carboxymethyl-(2-{carboxymethyl-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-ethyl)-amino]-ethyl}-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-acetic acid;compound with Al complex | {{2-[Carboxymethyl-(2-{carboxymethyl-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-ethyl)-amino]-ethyl}-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-acetic acid;compound with Zn complex |
Type | Small organic molecule |
Emp. Form. | C18H27N11O12S4 |
Mol. Mass. | 717.733 |
SMILES | NS(=O)(=O)c1nnc(NC(=O)CN(CCN(CCN(CC(O)=O)CC(=O)Nc2nnc(s2)S(N)(=O)=O)CC(O)=O)CC(O)=O)s1 |
Structure |
|