Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(3) dopamine receptor
LigandBDBM50109021
Substrate/Competitorn/a
Meas. Tech.ChEBML_62113
Ki 0.400000±n/a nM
Citation Mewshaw REZhao RShi XMarquis KBrennan JAMazandarani HCoupet JAndree TH New generation dopaminergic agents. Part 8: heterocyclic bioisosteres that exploit the 7-OH-2-(aminomethyl)chroman D(2) template. Bioorg Med Chem Lett 12:271-4 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
D(3) dopamine receptor
Name:D(3) dopamine receptor
Synonyms:D2-like dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3
Type:n/a
Mol. Mass.:44243.43
Organism:Homo sapiens (Human)
Description:n/a
Residue:400
Sequence:
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50109021
n/a
NameBDBM50109021
Synonyms:(R)-8-(Benzylamino-methyl)-3,6,7,8-tetrahydro-1H-chromeno[7,8-d]imidazol-2-one | CHEMBL420986
TypeSmall organic molecule
Emp. Form.C18H19N3O2
Mol. Mass.309.3624
SMILESO=c1[nH]c2ccc3CC[C@H](CNCc4ccccc4)Oc3c2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: