| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenylate kinase 2, mitochondrial |
|---|
| Ligand | BDBM50367065 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_32036 |
|---|
| Ki | 6700000±n/a nM |
|---|
| Citation |  Hampton, A; Picker, D; Nealy, KA; Maeda, M Use of adenine nucleotide derivatives to assess the potential of exo-active-site-directed reagents as species- or isozyme-specific enzyme inactivators. 4. Interactions of adenosine 5'-triphosphate derivatives with adenylate kinases from Escherichia coli and rat tissues. J Med Chem25:382-6 (1982) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenylate kinase 2, mitochondrial |
|---|
| Name: | Adenylate kinase 2, mitochondrial |
|---|
| Synonyms: | ADK2 | AK 2 | AK2 | ATP-AMP transphosphorylase 2 | Adenylate kinase 2 | Adenylate kinase 2, mitochondrial | KAD2_HUMAN |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 26480.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_32036 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSEL
GKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKE
KLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNE
KALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI
|
|
|
|---|
| BDBM50367065 |
|---|
| n/a |
|---|
| Name | BDBM50367065 |
|---|
| Synonyms: | CHEMBL608643 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H32N7O14P3 |
|---|
| Mol. Mass. | 663.4065 |
|---|
| SMILES | CC(=O)NCCCCCCNc1nc2c(N)ncnc2n1C1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
