| Reaction Details |
|---|
 | Report a problem with these data |
| Target | GTP:AMP phosphotransferase AK3, mitochondrial |
|---|
| Ligand | BDBM50367067 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_32199 (CHEMBL648978) |
|---|
| Ki | 2100000±n/a nM |
|---|
| Citation |  Hampton, A; Picker, D; Nealy, KA; Maeda, M Use of adenine nucleotide derivatives to assess the potential of exo-active-site-directed reagents as species- or isozyme-specific enzyme inactivators. 4. Interactions of adenosine 5'-triphosphate derivatives with adenylate kinases from Escherichia coli and rat tissues. J Med Chem25:382-6 (1982) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| GTP:AMP phosphotransferase AK3, mitochondrial |
|---|
| Name: | GTP:AMP phosphotransferase AK3, mitochondrial |
|---|
| Synonyms: | AK 3 | Adenylate kinase 3 | Adenylate kinase 3 alpha like 1 | Adenylate kinase 3 alpha-like 1 | Ak3 | Ak3l1 | Akl3l | GTP:AMP phosphotransferase mitochondrial | KAD3_RAT |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 25443.58 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_1340551 |
|---|
| Residue: | 227 |
|---|
| Sequence: | MGASGRLLRAVIMGAPGSGKGTGSSRITKHFELKHLSSGDLLRQNMLQGTEIAVLAKSFI
DQGKLIPDDDMTRLALHELKNLTQCSWLLDGFPRTLPQAEALDRVYQIDTVINLNVPFEV
IKLRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEAQT
EPVLQYYQKKGVLETFSGTETNKIRPHVYSFLQMKVPETIQKASVTP
|
|
|
|---|
| BDBM50367067 |
|---|
| n/a |
|---|
| Name | BDBM50367067 |
|---|
| Synonyms: | CHEMBL3350514 | CHEMBL612174 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H43IN7O15P3 |
|---|
| Mol. Mass. | 901.4726 |
|---|
| SMILES | CN(CCCCN(C)c1ncnc2n(cnc12)[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O)C(=O)CCCCCCNC(=O)CI |r| |
|---|
| Structure | 
|
|---|
Search and Browse
