Reaction Details |
| Report a problem with these data |
Target | Adenylate kinase 2, mitochondrial |
---|
Ligand | BDBM50367070 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_32036 |
---|
Ki | 7300000±n/a nM |
---|
Citation | Hampton, A; Picker, D; Nealy, KA; Maeda, M Use of adenine nucleotide derivatives to assess the potential of exo-active-site-directed reagents as species- or isozyme-specific enzyme inactivators. 4. Interactions of adenosine 5'-triphosphate derivatives with adenylate kinases from Escherichia coli and rat tissues. J Med Chem25:382-6 (1982) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Adenylate kinase 2, mitochondrial |
---|
Name: | Adenylate kinase 2, mitochondrial |
Synonyms: | ADK2 | AK 2 | AK2 | ATP-AMP transphosphorylase 2 | Adenylate kinase 2 | Adenylate kinase 2, mitochondrial | KAD2_HUMAN |
Type: | PROTEIN |
Mol. Mass.: | 26480.98 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_32036 |
Residue: | 239 |
Sequence: | MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSEL
GKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKE
KLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNE
KALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI
|
|
|
BDBM50367070 |
---|
n/a |
---|
Name | BDBM50367070 |
Synonyms: | CHEMBL609238 |
Type | Small organic molecule |
Emp. Form. | C16H30N7O13P3 |
Mol. Mass. | 621.3698 |
SMILES | NCCCCCCNc1nc2c(N)ncnc2n1C1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O |r| |
Structure |
|