Reaction Details |
| Report a problem with these data |
Target | Adenylate kinase 4, mitochondrial |
---|
Ligand | BDBM50010316 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_32194 |
---|
Ki | 4800000±n/a nM |
---|
Citation | Hampton, A; Picker, D; Nealy, KA; Maeda, M Use of adenine nucleotide derivatives to assess the potential of exo-active-site-directed reagents as species- or isozyme-specific enzyme inactivators. 4. Interactions of adenosine 5'-triphosphate derivatives with adenylate kinases from Escherichia coli and rat tissues. J Med Chem25:382-6 (1982) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Adenylate kinase 4, mitochondrial |
---|
Name: | Adenylate kinase 4, mitochondrial |
Synonyms: | AK3 | AK3L1 | AK4 | ATP-AMP transphosphorylase | Adenylate kinase 3-like | Adenylate kinase 4 | Adenylate kinase isoenzyme 4, mitochondrial | KAD4_HUMAN |
Type: | PROTEIN |
Mol. Mass.: | 25273.76 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_32194 |
Residue: | 223 |
Sequence: | MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEK
SLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLK
DRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKP
VIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
|
|
|
BDBM50010316 |
---|
n/a |
---|
Name | BDBM50010316 |
Synonyms: | CHEMBL3251364 |
Type | Small organic molecule |
Emp. Form. | C17H28IN6O14P3 |
Mol. Mass. | 760.2618 |
SMILES | O[C@@H]1[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O[C@H]([C@@H]1O)n1cnc2c(NCCCCCNC(=O)CI)ncnc12 |r| |
Structure |
|