Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 1 (5-HT1) receptor
LigandBDBM50026971
Substrate/Competitorn/a
Meas. Tech.ChEMBL_201211
Ki 12±n/a nM
Citation Remy DCBritcher SFKing SWAnderson PSHunt CARandall WCBélanger PAtkinson JGGirard YRooney CSFuentes JJTotaro JARobinson JLRisley EAWilliams M Synthesis and receptor binding studies relevant to the neuroleptic activities of some 1-methyl-4-piperidylidene-9-substituted-pyrrolo[2,1-b][3]benzazepine derivatives. J Med Chem 26:974-80 (1983) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Serotonin 1 (5-HT1) receptor
Name:Serotonin 1 (5-HT1) receptor
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 193825
Components:This complex has 4 components.
Component 1
Name:Serotonin 1B/1D receptor
Synonyms:5-HT-1D | 5-HT1D | 5-hydroxytryptamine receptor 1D | Serotonin 1 (5-HT1) receptor | Serotonin receptor 1D
Type:Enzyme Catalytic Domain
Mol. Mass.:41551.75
Organism:RAT
Description:5-HT1D HTR1D RAT::P28565
Residue:374
Sequence:
MSLPNQSLEGLPQEASNRSLNATGAWDPEVLQALRISLVVVLSIITLATVLSNAFVLTTI
LLTKKLHTPANYLIGSLATTDLLVSILVMPISIAYTTTRTWNFGQILCDIWVSSDITCCT
ASILHLCVIALDRYWAITDALEYSKRRTAGHAAAMIAAVWAISICISIPPLFWRQATAHE
EMSDCLVNTSQISYTIYSTCGAFYIPSILLIILYGRIYVAARSRILNPPSLYGKRFTTAQ
LITGSAGSSLCSLNPSLHESHTHTVGSPLFFNQVKIKLADSILERKRISAARERKATKTL
GIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPVIYTVFNEDF
RQAFQRVVHFRKAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Serotonin 1 (5-HT1) receptor
Synonyms:5-HT-1A | 5-HT1 | 5-HT1A | 5-Hydroxytryptamine receptor 1A (5-HT1A) | 5-hydroxytryptamine receptor 1A | 5-hydroxytryptamine receptor 1A (5HT1A) | G-21 | Serotonin 1a (5-HT1a) receptor/Adrenergic receptor alpha-1 | Serotonin receptor 1A
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:46445.29
Organism:Rattus norvegicus (rat)
Description:Binding assays were performed using rat hippocampal membranes.
Residue:422
Sequence:
MDVFSFGQGNNTTASQEPFGTGGNVTSISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVRKVEKKGAGT
SLGTSSAPPPKKSLNGQPGSGDWRRCAENRAVGTPCTNGAVRQGDDEATLEVIEVHRVGN
SKEHLPLPSESGSNSYAPACLERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPALLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 3
Name:Serotonin 1B/1D receptor
Synonyms:5-HT-1B | 5-HT1B | 5-hydroxytryptamine receptor 1B (5HT1B) | Serotonin 1 (5-HT1) receptor | Serotonin receptor 1B
Type:Protein
Mol. Mass.:43173.33
Organism:Rattus norvegicus (Rat)
Description:P28564
Residue:386
Sequence:
MEEQGIQCAPPPPATSQTGVPLANLSHNCSADDYIYQDSIALPWKVLLVALLALITLATT
LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDF
WLSSDITCCTASIMHLCVIALDRYWAITDAVDYSAKRTPKRAAIMIVLVWVFSISISLPP
FFWRQAKAEEEVLDCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQTP
NKTGKRLTRAQLITDSPGSTSSVTSINSRVPEVPSESGSPVYVNQVKVRVSDALLEKKKL
MAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLI
NPIIYTMSNEDFKQAFHKLIRFKCTG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 4
Name:HTR1F
Synonyms:5-HT-1F | 5-HT1F | 5-hydroxytryptamine receptor 1F | Serotonin 1 (5-HT1) receptor | Serotonin 1f (5-HT1f) receptor | Serotonin receptor 1F
Type:Enzyme Catalytic Domain
Mol. Mass.:41896.93
Organism:RAT
Description:5-HT1F HTR1F RAT::P30940
Residue:366
Sequence:
MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINCLVITAIIVTRKLHHPANY
LICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQGLCDLWLSVDIICCTCSILHLSAIALD
RYRAITDAVEYARKRTPRHAGITITTVWVISVFISVPPLFWRHQGNSRDDQCIIKHDHIV
STIYSTFGAFYIPLVLILILYYKIYRAARTLYHKRQASRMIKEELNGQVLLESGEKSIKL
VSTSYMLEKSLSDPSTDFDRIHSTVKSPRSELKHEKSWRRQKISGTRERKAATTLGLILG
AFVICWLPFFVKELVVNICEKCKISEEMSNFLAWLGYLNSLINPLIYTIFNEDFKKAFQK
LVRCRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50026971
n/a
NameBDBM50026971
Synonyms:11-(1-Methyl-piperidin-4-ylidene)-11H-benzo[d]pyrrolo[1,2-a]azepine-9-carbonitrile | CHEMBL178376
TypeSmall organic molecule
Emp. Form.C20H19N3
Mol. Mass.301.385
SMILES[#6]-[#7]-1-[#6]-[#6]\[#6](-[#6]-[#6]-1)=[#6]-1\c2cccn2-[#6]=[#6]-c2ccc(cc-12)C#N |c:15|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: