Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50026317 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_54542 (CHEMBL664859) |
---|
Ki | 0.470000±n/a nM |
---|
Citation | Kuyper, LF; Roth, B; Baccanari, DP; Ferone, R; Beddell, CR; Champness, JN; Stammers, DK; Dann, JG; Norrington, FE; Baker, DJ Receptor-based design of dihydrofolate reductase inhibitors: comparison of crystallographically determined enzyme binding with enzyme affinity in a series of carboxy-substituted trimethoprim analogues. J Med Chem28:303-11 (1985) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | Dihydrofolate reductase (F31V) | dfrA17 |
Type: | n/a |
Mol. Mass.: | 17532.46 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 157 |
Sequence: | MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
|
|
|
BDBM50026317 |
---|
n/a |
---|
Name | BDBM50026317 |
Synonyms: | 4-[5-(2,4-Diamino-pyrimidin-5-ylmethyl)-2,3-dimethoxy-phenoxy]-butyric acid ethyl ester | CHEMBL14002 | TCMDC-137356 |
Type | Small organic molecule |
Emp. Form. | C19H26N4O5 |
Mol. Mass. | 390.4335 |
SMILES | CCOC(=O)CCCOc1cc(Cc2cnc(N)nc2N)cc(OC)c1OC |
Structure |
|