| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50026317 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_54542 (CHEMBL664859) |
|---|
| Ki | 0.470000±n/a nM |
|---|
| Citation |  Kuyper, LF; Roth, B; Baccanari, DP; Ferone, R; Beddell, CR; Champness, JN; Stammers, DK; Dann, JG; Norrington, FE; Baker, DJ Receptor-based design of dihydrofolate reductase inhibitors: comparison of crystallographically determined enzyme binding with enzyme affinity in a series of carboxy-substituted trimethoprim analogues. J Med Chem28:303-11 (1985) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | Dihydrofolate reductase (F31V) | dfrA17 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 17532.46 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | n/a |
|---|
| Residue: | 157 |
|---|
| Sequence: | MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
|
|
|
|---|
| BDBM50026317 |
|---|
| n/a |
|---|
| Name | BDBM50026317 |
|---|
| Synonyms: | 4-[5-(2,4-Diamino-pyrimidin-5-ylmethyl)-2,3-dimethoxy-phenoxy]-butyric acid ethyl ester | CHEMBL14002 | TCMDC-137356 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H26N4O5 |
|---|
| Mol. Mass. | 390.4335 |
|---|
| SMILES | CCOC(=O)CCCOc1cc(Cc2cnc(N)nc2N)cc(OC)c1OC |
|---|
| Structure | 
|
|---|
Search and Browse
