Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50026384 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_53934 |
---|
IC50 | 71±n/a nM |
---|
Citation | Taylor, EC; Harrington, PJ; Fletcher, SR; Beardsley, GP; Moran, RG Synthesis of the antileukemic agents 5,10-dideazaaminopterin and 5,10-dideaza-5,6,7,8-tetrahydroaminopterin. J Med Chem28:914-21 (1985) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_LACCA | dhfR | folA |
Type: | PROTEIN |
Mol. Mass.: | 18437.08 |
Organism: | Lactobacillus casei |
Description: | ChEMBL_1357878 |
Residue: | 163 |
Sequence: | MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
|
|
|
BDBM50026384 |
---|
n/a |
---|
Name | BDBM50026384 |
Synonyms: | 2-{4-[2-(2,4-Diamino-5,6,7,8-tetrahydro-pyrido[2,3-d]pyrimidin-6-yl)-ethyl]-benzoylamino}-pentanedioic acid | CHEMBL173271 |
Type | Small organic molecule |
Emp. Form. | C21H26N6O5 |
Mol. Mass. | 442.4683 |
SMILES | Nc1nc(N)c2CC(CCc3ccc(cc3)C(=O)NC(CCC(O)=O)C(O)=O)CNc2n1 |
Structure |
|