Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50226277 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_54888 (CHEMBL666942) |
---|
IC50 | 5.98±n/a nM |
---|
Citation | Piper, JR; McCaleb, GS; Montgomery, JA; Kisliuk, RL; Gaumont, Y; Sirotnak, FM Syntheses and antifolate activity of 5-methyl-5-deaza analogues of aminopterin, methotrexate, folic acid, and N10-methylfolic acid. J Med Chem29:1080-7 (1986) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_LACCA | dhfR | folA |
Type: | PROTEIN |
Mol. Mass.: | 18437.08 |
Organism: | Lactobacillus casei |
Description: | ChEMBL_1357878 |
Residue: | 163 |
Sequence: | MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
|
|
|
BDBM50226277 |
---|
n/a |
---|
Name | BDBM50226277 |
Synonyms: | CHEMBL273509 |
Type | Small organic molecule |
Emp. Form. | C22H24N6O6 |
Mol. Mass. | 468.4626 |
SMILES | CN(Cc1cnc2nc(N)nc(O)c2c1C)c1ccc(cc1)C(=O)NC(CCC(O)=O)C(O)=O |
Structure |
|