Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM18050 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_54407 (CHEMBL667165) |
---|
pH | 6±n/a |
---|
Kd | 3.2±n/a nM |
---|
Comments | extracted |
---|
Citation | Taira, K; Benkovic, SJ Evaluation of the importance of hydrophobic interactions in drug binding to dihydrofolate reductase. J Med Chem31:129-37 (1988) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | Dihydrofolate reductase (F31V) | dfrA17 |
Type: | n/a |
Mol. Mass.: | 17532.46 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 157 |
Sequence: | MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
|
|
|
BDBM18050 |
---|
n/a |
---|
Name | BDBM18050 |
Synonyms: | 2-[(4-{[(2,4-diaminopteridin-6-yl)methyl](methyl)amino}phenyl)formamido]pentanedioic acid | CHEMBL34259 | MTX | Methotrexate | cid_126941 |
Type | Small organic molecule |
Emp. Form. | C20H22N8O5 |
Mol. Mass. | 454.4393 |
SMILES | CN(Cc1cnc2nc(N)nc(N)c2n1)c1ccc(cc1)C(=O)N[C@@H](CCC(O)=O)C(O)=O |r| |
Structure |
|