Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50023405 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_54449 (CHEMBL669303) |
---|
IC50 | 38±n/a nM |
---|
Citation | Rosowsky, A; Bader, H; Forsch, RA; Moran, RG; Freisheim, JH Methotrexate analogues. 31. Meta and ortho isomers of aminopterin, compounds with a double bond in the side chain, and a novel analogue modified at the alpha-carbon: chemical and in vitro biological studies. J Med Chem31:763-8 (1988) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_MOUSE | Dhfr |
Type: | Enzyme |
Mol. Mass.: | 21608.82 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50023405 |
---|
n/a |
---|
Name | BDBM50023405 |
Synonyms: | 3-(Carboxymethyl-{4-[(2,4-diamino-pteridin-6-ylmethyl)-methyl-amino]-benzoyl}-amino)-propionic acid | CHEMBL164823 |
Type | Small organic molecule |
Emp. Form. | C20H22N8O5 |
Mol. Mass. | 454.4393 |
SMILES | CN(Cc1cnc2nc(N)nc(N)c2n1)c1ccc(cc1)C(=O)N(CCC(O)=O)CC(O)=O |
Structure |
|