Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50367055 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_54452 |
---|
IC50 | 25±n/a nM |
---|
Citation | Rosowsky, A; Bader, H; Kohler, W; Freisheim, JH; Moran, RG Methotrexate analogues. 34. Replacement of the glutamate moiety in methotrexate and aminopterin by long-chain 2-aminoalkanedioic acids. J Med Chem31:1338-44 (1988) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_MOUSE | Dhfr |
Type: | Enzyme |
Mol. Mass.: | 21608.82 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50367055 |
---|
n/a |
---|
Name | BDBM50367055 |
Synonyms: | 4-Aminofolic acid | 4-Aminopteroic acid | AMINOPTERIN | Aminopteroylglutamic acid |
Type | Small organic molecule |
Emp. Form. | C19H20N8O5 |
Mol. Mass. | 440.4127 |
SMILES | Nc1nc(N)c2nc(CNc3ccc(cc3)C(=O)N[C@@H](CCC(O)=O)C(O)=O)cnc2n1 |r| |
Structure |
|