Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM51757 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_159302 (CHEMBL769355) |
---|
IC50 | 300000±n/a nM |
---|
Citation | DeCamp, DL; Babé, LM; Salto, R; Lucich, JL; Koo, MS; Kahl, SB; Craik, CS Specific inhibition of HIV-1 protease by boronated porphyrins. J Med Chem35:3426-8 (1992) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM51757 |
---|
n/a |
---|
Name | BDBM51757 |
Synonyms: | 3-[(1Z,4Z,9Z,15Z)-18-(2-Carboxy-ethyl)-3,7,12,17-tetramethyl-8,13-divinyl-porphyrin-2-yl]-propionic acid | 3-[18-(2-carboxyethyl)-3,7,12,17-tetramethyl-8,13-divinyl-22,23-dihydroporphin-2-yl]propionic acid | 3-[18-(2-carboxyethyl)-8,13-bis(ethenyl)-3,7,12,17-tetramethyl-22,23-dihydroporphyrin-2-yl]propanoic acid | 3-[8,13-bis(ethenyl)-18-(3-hydroxy-3-oxopropyl)-3,7,12,17-tetramethyl-22,23-dihydroporphyrin-2-yl]propanoic acid | CHEMBL267548 | MLS001074731 | PROTOPORPHYRIN IX | SMR000127405 | cid_4971 |
Type | Small organic molecule |
Emp. Form. | C34H34N4O4 |
Mol. Mass. | 562.6582 |
SMILES | Cc1c(CCC(O)=O)c2cc3nc(cc4[nH]c(cc5[nH]c(cc1n2)c(C)c5C=C)c(C)c4C=C)c(C)c3CCC(O)=O |
Structure |
|