| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50004786 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_79800 |
|---|
| IC50 | 5000±n/a nM |
|---|
| Citation |  DeCamp, DL; Babé, LM; Salto, R; Lucich, JL; Koo, MS; Kahl, SB; Craik, CS Specific inhibition of HIV-1 protease by boronated porphyrins. J Med Chem35:3426-8 (1992) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50004786 |
|---|
| n/a |
|---|
| Name | BDBM50004786 |
|---|
| Synonyms: | CHEMBL268410 | Porphyrin analogue |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C78H94N4O12 |
|---|
| Mol. Mass. | 1279.6006 |
|---|
| SMILES | Cc1c(CCC(O)=O)c2cc3nc(cc4[nH]c(cc5[nH]c(cc1n2)c(C)c5C(COC(=O)C12C[C@H]5C[C@H](C[C@H](C5)C1)C2)OC(=O)C12C[C@H]5C[C@H](C[C@H](C5)C1)C2)c(C)c4C(COC(=O)C12C[C@H]4C[C@H](C[C@H](C4)C1)C2)OC(=O)C12C[C@H]4C[C@H](C[C@H](C4)C1)C2)c(C)c3CCC(O)=O |TLB:48:49:53:46.47.52,35:36:40:33.34.39,70:65:72:71.69.68,70:69:72:64.65.66,THB:81:80:77:84.82.83,81:82:77:85.80.79,48:47:53:54.49.50,35:34:40:41.36.37| |
|---|
| Structure | 
|
|---|
Search and Browse
