| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 3',5'-cyclic-AMP phosphodiesterase |
|---|
| Ligand | BDBM14754 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_155847 (CHEMBL766943) |
|---|
| IC50 | 1700±n/a nM |
|---|
| Citation |  Takase, Y; Saeki, T; Fujimoto, M; Saito, I Cyclic GMP phosphodiesterase inhibitors. 1. The discovery of a novel potent inhibitor, 4-((3,4-(methylenedioxy)benzyl)amino)-6,7,8-trimethoxyquinazoline. J Med Chem36:3765-70 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 3',5'-cyclic-AMP phosphodiesterase |
|---|
| Name: | 3',5'-cyclic-AMP phosphodiesterase |
|---|
| Synonyms: | Phosphodiesterase 4A |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 13615.65 |
|---|
| Organism: | Sus scrofa |
|---|
| Description: | ChEMBL_155848 |
|---|
| Residue: | 118 |
|---|
| Sequence: | PWLVGWWDQFKRMLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVDIPSPTMKDHEKQQ
APRQRPSQQPPPPGPQFQPMSQITGVKKLMHSSSLNEDSSIPRFGVKTDQEELLAQEL
|
|
|
|---|
| BDBM14754 |
|---|
| n/a |
|---|
| Name | BDBM14754 |
|---|
| Synonyms: | 1-[(3,4-dimethoxyphenyl)methyl]-6,7-dimethoxy-isoquinoline | 1-[(3,4-dimethoxyphenyl)methyl]-6,7-dimethoxyisoquinoline | 6,7-dimethoxy-1-veratryl-isoquinoline;hydrochloride | CHEMBL19224 | Papaverine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H21NO4 |
|---|
| Mol. Mass. | 339.385 |
|---|
| SMILES | COc1ccc(Cc2nccc3cc(OC)c(OC)cc23)cc1OC |
|---|
| Structure | 
|
|---|
Search and Browse
