Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50047727
Substrate/Competitorn/a
Meas. Tech.ChEMBL_226569
Ki 2.5±n/a nM
Citation He XSBowen WDLee KSWilliams WWeinberger DRde Costa BR Synthesis and binding characteristics of potential SPECT imaging agents for sigma-1 and sigma-2 binding sites. J Med Chem 36:566-71 (1993) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma non-opioid intracellular receptor 1
Synonyms:Aging-associated gene 8 protein | SIG-1R | SR-BP | SR31747-binding protein | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1
Type:Enzyme Catalytic Domain
Mol. Mass.:25124.85
Organism:Homo sapiens (Human)
Description:Sigma 0 HUMAN::Q99720
Residue:223
Sequence:
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50047727
n/a
NameBDBM50047727
Synonyms:CHEMBL152057 | [2-(3-Iodo-phenyl)-ethyl]-methyl-(2-pyrrolidin-1-yl-ethyl)-amine
TypeSmall organic molecule
Emp. Form.C15H23IN2
Mol. Mass.358.261
SMILESCN(CCN1CCCC1)CCc1cccc(I)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: