| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50046932 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_157562 (CHEMBL763314) |
|---|
| Ki | 5±n/a nM |
|---|
| Citation |  Thaisrivongs, S; Turner, SR; Strohbach, JW; TenBrink, RE; Tarpley, WG; McQuade, TJ; Heinrikson, RL; Tomasselli, AG; Hui, JO; Howe, WJ Inhibitors of the protease from human immunodeficiency virus: synthesis, enzyme inhibition, and antiviral activity of a series of compounds containing the dihydroxyethylene transition-state isostere. J Med Chem36:941-52 (1993) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50046932 |
|---|
| n/a |
|---|
| Name | BDBM50046932 |
|---|
| Synonyms: | CHEMBL173255 | N-(4-{1-[(1H-Benzoimidazol-2-ylmethyl)-carbamoyl]-2-methyl-butylcarbamoyl}-1-cyclohexylmethyl-2,3-dihydroxy-5-methyl-hexyl)-2-[2-(2-methoxy-ethoxy)-ethoxy]-benzamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C43H57N5O6S |
|---|
| Mol. Mass. | 772.008 |
|---|
| SMILES | CCC(C)[C@H](NC(=O)[C@H](C(C)C)[C@@H](O)[C@H](O)C(CC1CCCCC1)NC(=O)c1ccccc1OCSc1ccccc1)C(=O)NCc1nc2ccccc2[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
