| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50041670 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_54442 (CHEMBL669645) |
|---|
| IC50 | 2.1±n/a nM |
|---|
| Citation |  Kotake, Y; Iijima, A; Yoshimatsu, K; Tamai, N; Ozawa, Y; Koyanagi, N; Kitoh, K; Nomura, H Synthesis and antitumor activities of novel 6-5 fused ring heterocycle antifolates: N-[4-[omega-(2-amino-4-substituted-6,7-dihydrocyclopenta [d]pyrimidin-5-yl)alkyl]benzoyl]-L-glutamic acids. J Med Chem37:1616-24 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_MOUSE | Dhfr |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21608.82 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | n/a |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
|---|
| BDBM50041670 |
|---|
| n/a |
|---|
| Name | BDBM50041670 |
|---|
| Synonyms: | 2-{4-[2-(2-Amino-4-hydroxy-6,7-dihydro-5H-cyclopentapyrimidin-5-yl)-ethyl]-benzoylamino}-pentanedioic acid | CHEMBL296190 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H24N4O6 |
|---|
| Mol. Mass. | 428.4385 |
|---|
| SMILES | Nc1nc2CCC(CCc3ccc(cc3)C(=O)NC(CCC(O)=O)C(O)=O)c2c(=O)[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
