Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeprilysin
LigandBDBM50024102
Substrate/Competitorn/a
Meas. Tech.ChEMBL_144472
Ki 1.9±n/a nM
Citation Gomez-Monterrey IBeaumont ANemecek PRoques BPFournie-Zaluski MC New thiol inhibitors of neutral endopeptidase EC 3.4.24.11: synthesis and enzyme active-site recognition. J Med Chem 37:1865-73 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Neprilysin
Name:Neprilysin
Synonyms:Atriopeptidase | CD10 antigen | CD_antigen=CD10 | Enkephalinase | NEP | Neutral Endopeptidase | Neutral endopeptidase 24.11
Type:Enzyme
Mol. Mass.:85570.75
Organism:Oryctolagus cuniculus (rabbit)
Description:NEP was purified to homogeneity from rabbit kidney.
Residue:750
Sequence:
MGRSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTVIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDATAEPCTDFFKYACGGWLKRNVIPETSSRYSNFDILRDELEVILKD
VLQEPKTEDIVAVQKAKTLYRSCVNETAIDSRGGQPLLKLLPDVYGWPVATQNWEQTYGT
SWSAEKSIAQLNSNYGKKVLINFFVGTDDKNSMNHIIHIDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMIAVAKLIRQEEGLPIDENQISVEMNKVMELEKEIANATTKSEDRNDPMLLY
NKMTLAQIQNNFSLEINGKPFSWSNFTNEIMSTVNINIPNEEDVVVYAPEYLIKLKPILT
KYFPRDFQNLFSWRFIMDLVSSLSRTYKDSRNAFRKALYGTTSESATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKKAEEKALAIKERI
GYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWITGAA
IVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSANNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGIGQAYR
AYQNYVKKNGEEKLLPGIDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GSLQNSVEFSEAFQCPKNSYMNPEKKCRVW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50024102
n/a
NameBDBM50024102
Synonyms:((S)-2-Mercaptomethyl-3-phenyl-propionylamino)-acetic acid | (2-MERCAPTOMETHYL-3-PHENYL-PROPIONYL)-GLYCINE | (S) (2-Mercaptomethyl-3-phenyl-propionylamino)-acetic acid | 2-[1-(2-Carboxy-2-hydroxy-ethylcarbamoyl)-2-phenyl-ethylamino]-4-phenyl-butyric acid(Thiorphan) | CHEMBL298827
TypeSmall organic molecule
Emp. Form.C12H15NO3S
Mol. Mass.253.317
SMILESOC(=O)CNC(=O)[C@@H](CS)Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: