Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50039028 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_221919 (CHEMBL842484) |
---|
IC50 | 143±n/a nM |
---|
Citation | Calderon, SN; Rothman, RB; Porreca, F; Flippen-Anderson, JL; McNutt, RW; Xu, H; Smith, LE; Bilsky, EJ; Davis, P; Rice, KC Probes for narcotic receptor mediated phenomena. 19. Synthesis of (+)-4-[(alpha R)-alpha-((2S,5R)-4-allyl-2,5-dimethyl-1-piperazinyl)-3- methoxybenzyl]-N,N-diethylbenzamide (SNC 80): a highly selective, nonpeptide delta opioid receptor agonist. J Med Chem37:2125-8 (1994) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50039028 |
---|
n/a |
---|
Name | BDBM50039028 |
Synonyms: | 4-[(4-Allyl-2,5-dimethyl-piperazin-1-yl)-(3-hydroxy-phenyl)-methyl]-N,N-diethyl-benzamide | CHEMBL303855 |
Type | Small organic molecule |
Emp. Form. | C27H37N3O2 |
Mol. Mass. | 435.6016 |
SMILES | CCN(CC)C(=O)c1ccc(cc1)C(N1CC(C)N(CC=C)CC1C)c1cccc(O)c1 |
Structure |
|