| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50039195 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_201099 (CHEMBL807414) |
|---|
| Ki | 40±n/a nM |
|---|
| Citation |  Calderon, SN; Izenwasser, S; Heller, B; Gutkind, JS; Mattson, MV; Su, TP; Newman, AH Novel 1-phenylcycloalkanecarboxylic acid derivatives are potent and selective sigma 1 ligands. J Med Chem37:2285-91 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50039195 |
|---|
| n/a |
|---|
| Name | BDBM50039195 |
|---|
| Synonyms: | 2-Phenyl-propionic acid 2-(2-diethylamino-ethoxy)-ethyl ester | CHEMBL309172 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H27NO3 |
|---|
| Mol. Mass. | 293.4012 |
|---|
| SMILES | CCN(CC)CCOCCOC(=O)C(C)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
