| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Ligand | BDBM50031896 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_204891 (CHEMBL808561) |
|---|
| Ki | 0.27±n/a nM |
|---|
| Citation |  Frye, SV; Haffner, CD; Maloney, PR; Hiner, RN; Dorsey, GF; Noe, RA; Unwalla, RJ; Batchelor, KW; Bramson, HN; Stuart, JD Structure-activity relationships for inhibition of type 1 and 2 human 5 alpha-reductase and human adrenal 3 beta-hydroxy-delta 5-steroid dehydrogenase/3-keto-delta 5-steroid isomerase by 6-azaandrost-4-en-3-ones: optimization of the C17 substituent. J Med Chem38:2621-7 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Name: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Synonyms: | S5A1_RAT | Srd5a1 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 29788.29 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_1441437 |
|---|
| Residue: | 259 |
|---|
| Sequence: | MVPLMELDELCLLDMLVYLEGFMAFVSIVGLRSVGSPYGRYSPQWPGIRVPARPAWFIQE
LPSMAWPLYEYIRPAAARLGNLPNRVLLAMFLIHYVQRTLVFPVLIRGGKPTLLVTFVLA
FLFCTFNGYVQSRYLSQFAVYAEDWVTHPCFLTGFALWLVGMVINIHSDHILRNLRKPGE
TGYKIPRGGLFEYVSAANYFGELVEWCGFALASWSLQGVVFALFTLSTLLTRAKQHHQWY
HEKFEDYPKSRKILIPFVL
|
|
|
|---|
| BDBM50031896 |
|---|
| n/a |
|---|
| Name | BDBM50031896 |
|---|
| Synonyms: | (1S,9aR,11aS)-9a,11a-Dimethyl-7-oxo-2,3,3a,3b,4,5,7,8,9,9a,9b,10,11,11a-tetradecahydro-1H-cyclopenta[i]phenanthridine-1-carboxylic acid (2,5-bis-trifluoromethyl-phenyl)-amide | CHEMBL327702 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H30F6N2O2 |
|---|
| Mol. Mass. | 528.5297 |
|---|
| SMILES | C[C@]12CCC3C(CN=C4CC(=O)CC[C@]34C)C1CC[C@@H]2C(=O)Nc1cc(ccc1C(F)(F)F)C(F)(F)F |t:7| |
|---|
| Structure | 
|
|---|
Search and Browse
